1. Notes: 25176 / 1 month ago  from poopoopoopoopoopoopoopoop (originally from kajrare)

    Surely, I’m not Shirley.

    (Source: kajrare)

  2. Notes

    1. musicinmyworld reblogged this from perceptualize
    2. damselofdeath reblogged this from 10scenepointstothewinner
    3. young-and-hostilebutnotstupid reblogged this from 5446thatsmynumber
    4. nicole-reesie reblogged this from kajrare
    5. thaliaramirez reblogged this from tinyobserver
    6. melodramatic-rubbish reblogged this from x24
    7. heavenisalibrary reblogged this from goldfish945
    8. kissmefuckingslowly reblogged this from jamjustine
    9. goldfish945 reblogged this from believe-holmes
    10. ernstn reblogged this from lostandnakedinthecityagain
    11. dead-worldleaders reblogged this from manlesbian
    12. manlesbian reblogged this from x24
    13. tomasthebreaker reblogged this from lostandnakedinthecityagain
    14. x24 reblogged this from lostandnakedinthecityagain and added:
      One of my favourite lines from dat film paha
    15. lostandnakedinthecityagain reblogged this from charity-case
    16. poopytits88 reblogged this from velociraptorsandcheese
    17. ravenwriting reblogged this from prettyalarming and added:
      YES! Exactly the picture I was looking for! :D
    18. prettyalarming reblogged this from ravenwriting
    19. ravenwriting reblogged this from captainsupergeek and added:
      Oh, of course! :D …I now have images in my head of that actually being in the show, but before it comes out, Benedict...
    20. captainsupergeek reblogged this from ravenwriting and added:
      Because we were joking about how Sherlock’s disguise would be a woman i.e. Shirley Holmes. XD
    21. ravenwriting reblogged this from captainsupergeek and added:
      YES! OMG MEGAN YOU ARE MY FAVORITE! Do you remember why the comparison was made? Because I remember it, but I can’t...
    22. captainsupergeek reblogged this from the-solitarypersianslipper and added:
      SARAH, SARAH, SARAH, LOOK! IT’S JOHN AND SHERLOCK!
    23. the-solitarypersianslipper reblogged this from pavlovsson
    24. velociraptorsandcheese reblogged this from theawkwardlemon
    25. theawkwardlemon reblogged this from slutssell
    26. the-domain-of-sound reblogged this from zsuki
    27. jrodgoodfella reblogged this from blogsofsam
    28. aogds reblogged this from letitcomeandletitbe
    29. johnny37564 reblogged this from eridaniella
    30. eridaniella reblogged this from figyelemelvonoegyszarvu
avatar_128
 
 
shayne: hoops hula | listens to jars of clay | in love with learning | is not worth keeping | stands on grace | a happy thought fairy | a missionary doctor in the making | walks by faith | could sing of His love forever :)
 
 

Following

calliope-winehikenow9gaghealinghopyabrokensupergirleatsleepdrawcharmyannmslilithfieldsofelysiumnoiseandmelodiesgihannagdgomezjosephineannepinoytumblrartpixiekamilnidabidtryphenahalcyon-dazedid-you-knoshufflindoorspisayforeverallthecutethingsjemapelleivyweallseekthetruthmaisieesshrobirobsterfuckyeahangelinakari-shmagingerangiej-p-gsurisburnbookblack-and-whitethrescamoviesinframesgivesmehopecacaococoamindyindemandlovemontagefashionblogsicanreadziesgotyouhighadriftinnothingnessvarcegalonelyeyesonlyflibbertigibbetymace-dthebeautyofsolitudeweareinfinitehipstersninolucerostafftheworldsgamesaabmagalonabornlippygisellegozumpoopoopoopoopoopoopoopoopkataliikeymikeytravelhighlightsilabdoggiesmisspatchtonighticanwritehowdoyousolvemariabismarkymarkc-ainqomaspeakupjadeofalltradesdianemagbuhatohlittlegirlinyikaraldgheraaipeethepanicroomserineestrawberryloveschocolatejulienotedwusheaprincessbratttiandv23joserizalsimplyintricatelaururuiamblessedlyricalgraphicsgoldnesscarkeesprettyfoodsfuckyeahrrrainbowsromeocatapbibidibabidiboomervthefourthfuck-yeah-antmwhatthefactwakingupslowjorebjosolmatalamwhatsthetimemojojovipaaauuweecouturecourieremotasticilovethe90spantsstoryboomayayfuckyeahellenpagetvquoteskstphilippinesstillflailingr-e-m-e-m-b-e-rmajnichaeliameyjeyfwonderspotmnklydenickoiiimedikongpinoymovieofthedayzooeydeschanelnewsfuckyeahcappiecaseyfishforpeoplepatreeshopinoypickuplinesfuckyeahzbzriacabrerayesitsnikkimusikero07toniccieyjeyfninetieskidmaydavidenilegna999anakatherinacottoncandycolors123saycheesesommersgossipguysgonetomauireblogifawesomerandomness
 

Tumblr